PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Carubv10007808m
Common NameCARUB_v10007808mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family WRKY
Protein Properties Length: 529aa    MW: 57435.6 Da    PI: 6.093
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Carubv10007808mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY101.93.6e-32163219259
                      --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
             WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                      +DgynWrKYGqK vkgse+prsYY+Ct+++C+vkkkvers+ +++++ei+Y g+Hnh+
  Carubv10007808m 163 EDGYNWRKYGQKLVKGSEYPRSYYKCTHPNCEVKKKVERSR-EGHIIEIIYAGSHNHT 219
                      8****************************************.***************8 PP

2WRKY99.52e-31354411158
                      ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS CS
             WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnh 58 
                      ldDgy+WrKYGqK+vkg+++prsYY+Ct +gC+v+k+ver+++d k v +tY g+H+h
  Carubv10007808m 354 LDDGYRWRKYGQKVVKGNPNPRSYYKCTANGCTVTKHVERASDDFKSVLTTYIGKHTH 411
                      59******************************************************** PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5081123.491157221IPR003657WRKY domain
Gene3DG3DSA:2.20.25.802.0E-28159221IPR003657WRKY domain
SuperFamilySSF1182902.35E-25160221IPR003657WRKY domain
SMARTSM007742.3E-34162220IPR003657WRKY domain
PfamPF031061.9E-24163218IPR003657WRKY domain
Gene3DG3DSA:2.20.25.805.8E-34339414IPR003657WRKY domain
SuperFamilySSF1182901.57E-27346414IPR003657WRKY domain
PROSITE profilePS5081134.578349414IPR003657WRKY domain
SMARTSM007747.2E-36354413IPR003657WRKY domain
PfamPF031063.6E-24355411IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009409Biological Processresponse to cold
GO:0009555Biological Processpollen development
GO:0009846Biological Processpollen germination
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 529 aa     Download sequence    Send to blast
MADFDNKAAV VGEQFDFSIM NEDSLQTSFH IKTTSCSGGA LRERISARSG FNAPSLNTED  60
ILQSTCLTIS SPGLSPATLL ESPVFLSNPL PSPTTGKLSS LPSDKAKDEL FDEITTSLAF  120
QSISGSSLDP TNIALEPDKS QDYEQRQVLG GLGDSMASGA PAEDGYNWRK YGQKLVKGSE  180
YPRSYYKCTH PNCEVKKKVE RSREGHIIEI IYAGSHNHTK PPPNRRSGIA SSGTGMDMQV  240
DGTEQEGFAG TNENLEWTSP TSELKYGSHS GSMQVQSGIQ FGFGDAAANA FFRDEDEDDR  300
TSHMSVSLSY DGEVDESESK RRKLEAYPAE MSGSTRASRE PRVVVQTTSD IDILDDGYRW  360
RKYGQKVVKG NPNPRSYYKC TANGCTVTKH VERASDDFKS VLTTYIGKHT HVVPAARNSS  420
HAGSGTPGTL QGNLTTQTHN HNVHYPVPHS RTEGLVRANA SLFDFQPHLR PPSGFSIPSL  480
PAPDIGDPAG LMLQLTAEPK VEPVSQQGLG LSASSLIYRE IMSRLPQI*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A1e-31163415878Probable WRKY transcription factor 4
2lex_A1e-31163415878Probable WRKY transcription factor 4
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY0526490.0AY052649.1 Arabidopsis thaliana WRKY transcription factor 34 (WRKY34) mRNA, complete cds.
GenBankBT0303610.0BT030361.1 Arabidopsis thaliana At4g26440 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006286239.10.0hypothetical protein CARUB_v10007808mg
SwissprotO655900.0WRK34_ARATH; Probable WRKY transcription factor 34
TrEMBLR0FAT40.0R0FAT4_9BRAS; Uncharacterized protein
STRINGfgenesh1_pm.C_scaffold_70012650.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM141811524
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G26440.10.0WRKY DNA-binding protein 34